PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g111830.1
Common NameMTR_077s0043, MTR_1g111830
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB
Protein Properties Length: 245aa    MW: 27600.6 Da    PI: 6.6103
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g111830.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.84.9e-082366344
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                      WT + d+l+ +a  + + +   +W++Ia+ ++ g+++ ++++++
  Medtr1g111830.1 23 QWTRDHDKLFERALLMVPEDlpdRWEKIAEQVP-GKSAAEIRDHY 66
                     6*****************99*************.**********9 PP

2Myb_DNA-binding45.51.8e-14125169347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + +++G+g+W++I+r +  +Rt+ q+ s+ qky
  Medtr1g111830.1 125 PWTEEEHRLFLIGLTKFGKGDWRSISRNVVVTRTPTQVASHAQKY 169
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512936.841976IPR017884SANT domain
SMARTSM007177.3E-62072IPR001005SANT/Myb domain
SuperFamilySSF466896.06E-112278IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.1E-52370IPR009057Homeodomain-like
PfamPF002492.4E-72367IPR001005SANT/Myb domain
CDDcd001671.98E-62470No hitNo description
PROSITE profilePS5129420.667118174IPR017930Myb domain
SuperFamilySSF466896.7E-17120175IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-17121173IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.603.9E-11122168IPR009057Homeodomain-like
SMARTSM007172.1E-10122172IPR001005SANT/Myb domain
CDDcd001676.47E-9125170No hitNo description
PfamPF002491.6E-11125169IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MYRESVAMAT TTAATRWPTQ PTQWTRDHDK LFERALLMVP EDLPDRWEKI AEQVPGKSAA  60
EIRDHYEALV HDILEIDSGR VEVPSYSDES AVSGGGLAEW DSSNQISFGS KPRHGGDNER  120
KKGTPWTEEE HRLFLIGLTK FGKGDWRSIS RNVVVTRTPT QVASHAQKYF LRQNSVKKER  180
KRSSIHDITS VDSNSAPVPI DQNWVPPPGG GSMQQQSPEM HHYPSNNLQD QMSAYGYSNY  240
GFQM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-141397280RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2350080.0AC235008.3 Medicago truncatula clone mth2-151p16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013470249.10.0MYB-like transcription factor family protein
SwissprotQ8S9H72e-59DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLG7ZYT00.0G7ZYT0_MEDTR; DnaJ homolog subfamily C member
STRINGGLYMA20G24600.11e-138(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.13e-81MYB family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]